CIntX Help

ENTER/UPLOAD THE PDB FILE
Ex. : 1COD
Note: Make sure the residue number of the PDB file starts with '1' and ends with 'n' without missing numbers. Also make sure residues represented in 'SEQRES' and in atomic coordinates are identical to each other.



ENTER THE AMINO ACID SEQUENCE AND RELATED STRUCTURAL INFORMATION

SEQUENCE
Enter the sequence.
Ex. : LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
(Case insensetive)

POSITION OF CYSTEINE RESIDUE(S)
Mention position of cysteine residues in the protein.
Ex. : 3 17 30 36

POSITION OF CIS PROLINE(S)
Mention proline residues which are in cis conformations.
Ex. : 12 44 48 52



ENTER THE EXPERIMENTAL CONDITIONS

pH
Enter the pH meter reading (Not corrected to D2O).
Ex. : 3.2

TEMPERATURE

Enter the temperature in Kelvin .
Ex. : 293 (If the temperature is 20 oC).

OTHER CONDITIONS

Define the ionic strength as low(<0.5 M) or high (>0.5 M).

CALCULATION OF FREE ENERGY EXCHANGE OF PROTEINS

Upload file containing kex values (in min-1).
Check example.